PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H04742.1.p
Common NameEUGRSUZ_H04742, LOC104415760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 344aa    MW: 38171.1 Da    PI: 5.5585
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H04742.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1868121356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Eucgr.H04742.1.p  68 KKRRLSIDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 121
                       4557999**********************************************9 PP

2HD-ZIP_I/II129.31.5e-4167159193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y+alk + ++L++++e+L++e+ke
  Eucgr.H04742.1.p  67 EKKRRLSIDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKSSYEALKLSYDALKHDNEALHKEIKE 159
                       69****************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.08663123IPR001356Homeobox domain
SuperFamilySSF466897.27E-1965125IPR009057Homeodomain-like
SMARTSM003897.4E-1866127IPR001356Homeobox domain
PfamPF000469.3E-1668121IPR001356Homeobox domain
CDDcd000861.59E-1668124No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1970130IPR009057Homeodomain-like
PRINTSPR000311.0E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5103119IPR000047Helix-turn-helix motif
PfamPF021834.9E-18123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MKRLGSSDSL GALMSICPPS EELQHSPRNG NPIYHSRDLQ SMLELGLDEE GCVEDQSAGG  60
GGHVGGEKKR RLSIDQVKAL EKNFEVENKL EPERKVKLAQ ELGLQPRQVA VWFQNRRARW  120
KTKQLERDYG VLKSSYEALK LSYDALKHDN EALHKEIKEL KSKLREEDDN PESNLSVKEE  180
VIIPSHDVSD KIRAADDGDD DTKRSPPPPI TAPPRELSFN NGGLKDGSSD SDSSAIVNEE  240
NAATSSSSPN PAVQSHGGFL KFMGSSSSSA SPPPPPPASF GGCFSFQFQR AYQPQPQPPH  300
HHHHHSPYVK MEEHNFLGGE EDCNFFSDEQ APTLHWYCPD QWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H04742.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025416.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A059B7730.0A0A059B773_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s07290.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-60homeobox protein 6